Proton-pump inhibitor proton-pump.com

Archives 2025

Featured Uncategorized

FK506 binding protein 10, 65 kDa

Proton-pump inhibitor 0 Comment

Product Name :
FK506 binding protein 10, 65 kDa

Target gene :
FKBP10

verified_species_reactivity :
Human

interspecies_information :
93%, ENSMUSG00000001555, species_id: MOUSE, 91%, ENSRNOG00000015941, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSRED

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000141756

Entrez :
60681

UniProt :
Q96AY3

Dilution:
1:20 – 1:50

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
375815-87-5 manufacturer 611168-24-2 IUPAC Name PMID:29494117 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

STAT3 Monoclonal Antibody (3G2D12), CoraLite® 555

Proton-pump inhibitor 0 Comment

Product Name :
STAT3 Monoclonal Antibody (3G2D12), CoraLite® 555

Species Reactivity:
Human, Mouse, Rat

Host/Isotype :
Mouse / IgG2a

Class:
Monoclonal

Type :
Antibody

Clone:
3G2D12

Conjugate :
CoraLite® 555 View additional formats CoraLite 594 CoraLite Plus 488 CoraLite Plus 647 Unconjugated

Form:
Liquid

Concentration :
1 mg/mL

Purification :
Protein A

Storage buffer:
PBS, pH 7.3, with 50% glycerol, 0.5% BSA

Contains :
0.05% ProClin 300

Storage conditions:
-20° C, Avoid Freeze/Thaw Cycles, store in dark

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
uPAR Antibody web PGA5 Antibody In stock PMID:35159107 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

Fanconi anemia complementation group F

Proton-pump inhibitor 0 Comment

Product Name :
Fanconi anemia complementation group F

Target gene :
FANCF

verified_species_reactivity :
Human

interspecies_information :
58%, ENSMUSG00000092118, species_id: MOUSE, 62%, ENSRNOG00000023968, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
GEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFR

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000183161

Entrez :
2188

UniProt :
Q9NPI8

Dilution:

Retrieval method :

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
81-24-3 supplier 54-05-7 Synonym PMID:29465928 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

ST2 Monoclonal Antibody (OTI5E10), TrueMAB™

Proton-pump inhibitor 0 Comment

Product Name :
ST2 Monoclonal Antibody (OTI5E10), TrueMAB™

Species Reactivity:
Human

Host/Isotype :
Mouse / IgG2b

Class:
Monoclonal

Type :
Antibody

Clone:
OTI5E10

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
1 mg/mL

Purification :
Protein A/G

Storage buffer:
PBS with 1% BSA, 50% glycerol

Contains :
0.02% sodium azide

Storage conditions:
-20° C, Avoid Freeze/Thaw Cycles

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Sulfasalazine custom synthesis CDKN1A Antibody Biological Activity PMID:34558062 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

ATP-binding cassette, sub-family B (MDR/TAP), member 9

Proton-pump inhibitor 0 Comment

Product Name :
ATP-binding cassette, sub-family B (MDR/TAP), member 9

Target gene :
ABCB9

verified_species_reactivity :
Human

interspecies_information :
100%, ENSMUSG00000029408, species_id: MOUSE, 99%, ENSRNOG00000001082, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
ESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLS

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000150967

Entrez :
23457

UniProt :
Q9NP78

Dilution:
1:20 – 1:50

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
50-49-7 References 51333-22-3 Biological Activity PMID:29697234 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

SSBP3 Monoclonal Antibody (3E6)

Proton-pump inhibitor 0 Comment

Product Name :
SSBP3 Monoclonal Antibody (3E6)

Species Reactivity:
Human

Host/Isotype :
Mouse / IgG2b, kappa

Class:
Monoclonal

Type :
Antibody

Clone:
3E6

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
0.41 mg/mL

Purification :
Affinity chromatography

Storage buffer:
PBS, pH 7.4

Contains :
no preservative

Storage conditions:
-20° C, Avoid Freeze/Thaw Cycles

RRID:
AB_2605677

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Bedinvetmab web Fenoverine Purity & Documentation PMID:35081420 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

family with sequence similarity 124A

Proton-pump inhibitor 0 Comment

Product Name :
family with sequence similarity 124A

Target gene :
FAM124A

verified_species_reactivity :
Human

interspecies_information :
68%, ENSMUSG00000035184, species_id: MOUSE, 70%, ENSRNOG00000009802, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
QWFSNTGAPGHRASEWRHGHLLSIDDLEGAQETDVDTGLRLSSSDLSVVSAYSAPSRFCSTVETPLPSERCSSHWAAHKDSREGPLPTVSRV

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000150510

Entrez :
220108

UniProt :
Q86V42

Dilution:
1:500 – 1:1000

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
310456-65-6 custom synthesis 58-85-5 web PMID:31334979 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

SRPR Polyclonal Antibody

Proton-pump inhibitor 0 Comment

Product Name :
SRPR Polyclonal Antibody

Species Reactivity:
Human, Mouse

Host/Isotype :
Rabbit / IgG

Class:
Polyclonal

Type :
Antibody

Clone:

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
0.37 mg/mL

Purification :
Antigen affinity chromatography

Storage buffer:
0.1M tris glycine, pH 7, with 10% glycerol

Contains :
0.01% thimerosal

Storage conditions:
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

RRID:
AB_2545771

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
PRMT6 Antibody site STAT1 α Antibody Autophagy PMID:35199647 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

glutamate-rich 6

Proton-pump inhibitor 0 Comment

Product Name :
glutamate-rich 6

Target gene :
ERICH6

verified_species_reactivity :
Human

interspecies_information :
77%, ENSMUSG00000070471, species_id: MOUSE, 76%, ENSRNOG00000013662, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
ISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIRRLFHKLEGCVNFPSSQVWEKLKQPSYLSSLSLKLIALCHSSGIKQD

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000163645

Entrez :
131831

UniProt :
Q7L0X2

Dilution:
1:200 – 1:500

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
3483-12-3 manufacturer 616-91-1 InChIKey PMID:29489192 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Featured Uncategorized

Abrilumab Biosimilar

Proton-pump inhibitor 0 Comment

Product Name :
Abrilumab Biosimilar

Host species :
Homo sapiens

Species reactivity :
Human

Form:
Liquid

Storage buffer :
0.01M PBS, pH 7.4.

Concentration:
1 mg/ml

Purity :
>95% by SDS-PAGE.

Clonality:
Monoclonal

Applications :
Research Grade Biosimilar

Target :
ITGA4, CD49d, CD49 antigen-like family member D, CD49D, VLA-4 subunit alpha, Integrin alpha-IV, Integrin alpha-4, Gut homing receptor beta subunit, Integrin beta-7, ITGB7

Purification:
XtenCHO

Endotoxin level.:
Please contact with the lab for this information.

Expression system :
XtenCHO

Accession :
P13612 & P26010

Stability and Storage:
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.Store at +4°C short term (1-2 weeks).Store at -20 °C 12 months. Store at -80°C long term.

Alternative Names:
AMG 181, MEDI-7183, CAS: 1342290-43-0

Note:
For research use only. Not suitable for clinical or therapeutic use.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
BMAL1 Antibody Purity & Documentation NPR1/NPRA Proteinmedchemexpress PMID:35187506 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com