Name :
DNAJC5 (Human) Recombinant Protein (P01)

Biological Activity :
Human DNAJC5 full-length ORF ( NP_079495.1, 1 a.a. – 198 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_079495.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=80331

Amino Acid Sequence :
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN

Molecular Weight :
48.5

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (99); Rat (99)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
DNAJC5

Gene Alias :
CSP, DKFZp434N1429, DKFZp761N1221, DNAJC5A, FLJ00118, FLJ13070

Gene Description :
DnaJ (Hsp40) homolog, subfamily C, member 5

Gene Summary :
subfamily C

Other Designations :
cysteine string protein

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-5 ProteinFormulation
B7-1/CD80 Recombinant Proteins
Popular categories:
Complement Factor H Related 5
Contactin-2

Product Name :
TROY Monoclonal Antibody (02)

Name :
SHCBP1 (Human) Recombinant Protein (P01)

Biological Activity :
Human SHCBP1 full-length ORF ( NP_079021.2, 1 a.a. – 672 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_079021.2

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=79801

Amino Acid Sequence :
MADGSLTGGGLEAAAMAPERTGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFMPEGKTFFPEIFQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWHTNVFKVLVEITDVDFAALKAVVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWVVFDDSGVFDQTALAIEHVRFFYQNIWRSWDEEEEDEYDYFVRCVEPRLRLHYDILEDRVPSGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENISMVEGLKLYSEMEQLKQKLKLIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTDRLCQEPGEEEREIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF

Molecular Weight :
102

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (77)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
SHCBP1

Gene Alias :
FLJ22009, MGC26900, PAL

Gene Description :
SHC SH2-domain binding protein 1

Gene Summary :

Other Designations :
–

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Gastric Inhibitory Peptide (GIP) MedChemExpress
Insulin-like Growth Factor I (IGF-1) site
Popular categories:
CD52
Angiopoietin-4

Product Name :
TRIM6 Polyclonal Antibody

Product Name :
TRIM28 Recombinant Rabbit Monoclonal Antibody (SD081-05)

Product Name :
TRADD Polyclonal Antibody

Name :
MRPS11 (Human) Recombinant Protein (P01)

Biological Activity :
Human MRPS11 full-length ORF ( NP_073750.2, 1 a.a. – 194 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_073750.2

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=64963

Amino Acid Sequence :
MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL

Molecular Weight :
47

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (71); Rat (74)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
MRPS11

Gene Alias :
FLJ22512, FLJ23406, HCC-2

Gene Description :
mitochondrial ribosomal protein S11

Gene Summary :
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms. [provided by RefSeq

Other Designations :
cervical cancer proto-oncogene 2

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CTGF MedChemExpress
MMP-9 medchemexpress
Popular categories:
Ubiquitin-Specific Protease 3
Ubiquitin-Specific Peptidase 35

Product Name :
TOX Monoclonal Antibody (TXRX10), eBioscience™

Name :
CENPK (Human) Recombinant Protein (P01)

Biological Activity :
Human CENPK full-length ORF ( AAH05400.1, 1 a.a. – 269 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH05400.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=64105

Amino Acid Sequence :
MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTAELSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKVETFSESRIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLITLHEMLEILINRLFDVPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ

Molecular Weight :
55.33

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (75); Rat (66)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
CENPK

Gene Alias :
AF5alpha, CENP-K, FKSG14, P33, Solt

Gene Description :
centromere protein K

Gene Summary :
CENPK is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM

Other Designations :
OTTHUMP00000161888|SoxLZ/Sox6 leucine zipper binding protein|SoxLZ/Sox6-binding protein Solt|leucine zipper protein FKSG14

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Dkk-1 Proteinweb
Cathepsin D Proteinsupplier
Popular categories:
Alpha-1 Antitrypsin 1-2
TREM-1/CD354

Erturb the structure of the DNA helix and it is well tolerated by a number of DNA and RNA polymerases. It is highly fluorescent and its excitation and emission are well to the red of most fluorescent nucleotide analogs, which eliminates or reduces background fluorescence from proteins.
2-Aminopurine (4) is a fluorescent base which has found significant use in probing DNA structures. It is especially useful in that it is capable of hybridizing to T.6 In 2001, Glen Research introduced furano-T (5) as a novel fluorescent nucleoside. It quickly became apparent that furano-T is unstable during cleavage and deprotection steps, but forms another fluorescent nucleoside on treatment with ammonium hydroxide. Mass spec data supported the conclusion that furano-T had been transformed
(Continued on Page 2)

Several fluorescent nucleoside analogues have been prepared as phosphoramidites in recent years. Etheno-A (1) and etheno-C (2)1 (Figure 1 on Page 2) are two readily accessible fluorescent structures but these molecules are both non-hybridizing. Other notable fluorescent base analogues are the pteridine nucleoside analogues actively being investigated by Pfleiderer, Hawkins and co-workers. The most promising analogue described to date2 is the adenosine analogue (3) but guanosine and other analogues have also been investigated.3-5

(Continued from Front Page)

by ammonium hydroxide in the cleavage and deprotection to the equivalent amino compound, pyrrolo-C (6) (Figure 1). FuranodT-CE Phosphoramidite (7) (Figure 2) was discontinued and Pyrrolo-dC-CE Phosphoramidite (8) (Figure 2), the fluorescent dC analogue, was introduced early in 2002. Pyrrolo-C CE Phosphoramidite (9) (Figure 2) for RNA synthesis has now also been synthesized and we foresee potential applications in RNA structural analysis. Chemistry Pyrrolo-dC is stable to all DNA synthesis cycles and reagents, with the exception of strong iodine oxidizer solutions. Routinely, 0.02M iodine oxidizer solutions are now used and these solutions have no effect on pyrrolo-dC. However, some older instruments and cycles use 0.1M iodine or stronger solutions and these cause degradation of pyrrolo-dC each cycle. These strong iodine solutions should not be used with pyrrolo-dC. Pyrrolo-dC is stable to most cleavage and deprotection conditions, including UltraMild with potassium carbonate in methanol or ammonium hydroxide at room temperature, and regular with ammonium hydroxide, preferably at room temperature. This analogue contrasts with the pyrrolo-dC derivative, lacking only the methyl group, described7 by Epoch researchers, which was unstable to deprotection conditions. They also observed that the non-methylated version of the ring system formed a mismatch with G, which differs from our observations for the pyrrolo-C – G base pair.42424-50-0 manufacturer

The quantum yield of fluorescence for pyrrolo-dC is quite sensitive to its hybridization state, making it ideally suited8,9 for probing the dynamic structure of DNA.1628208-23-0 web Work by Liu and Martin has shown9 that, when the pyrrolo-dC is mismatched in an otherwise duplex hybrid, the fluorescence is higher than the single-stranded species when the mismatched base is adenosine.PMID:28006892 This most likely arises from efficient energy transfer from the adenosine to the pyrrolodC. This unusual behavior also allows differentiation in situ between a DNA-DNA duplex and a DNA-RNA heteroduplex. Biology The quenching of pyrrolo-dC allows local structural changes to be probed with great sensitivity. Using pyrrolo.MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com