All posts by Proton-pump inhibitor

anti-MMP-9 antibody, Releviate Therapeutics

Product Name :
MMP-9

Target points:
Releviate Therapeutics

Status:

Organization :
Protein

Short name :
Homo sapiens

Type:

Organism:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Mepolizumab (anti-IL5) Immunology/Inflammation D(+)-Galactosamine Epigenetic Reader Domain PMID:34972858 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Rhox homeobox family, member 1

Product Name :
Rhox homeobox family, member 1

Target gene :
RHOXF1

verified_species_reactivity :
Human

interspecies_information :
48%, ENSMUSG00000023443, species_id: MOUSE, 47%, ENSRNOG00000053562, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
AMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWF

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000101883

Entrez :
158800

UniProt :
Q8NHV9

Dilution:
1:50 – 1:200

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
2636846-41-6 Data Sheet 3025082-14-5 site PMID:30252309 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

anti-IL-38 antibody, Fraunhofer

Product Name :
IL-38

Target points:
Fraunhofer-Gesellschaft

Status:

Organization :
Protein

Short name :
Homo sapiens

Type:

Organism:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Isatuximab (anti-CD38) In Vivo Fruquintinib custom synthesis PMID:35172301 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

receptor accessory protein 1

Product Name :
receptor accessory protein 1

Target gene :
REEP1

verified_species_reactivity :
Human

interspecies_information :
92%, ENSMUSG00000052852, species_id: MOUSE, 96%, ENSRNOG00000008481, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
MQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGT

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000068615

Entrez :
65055

UniProt :
Q9H902

Dilution:
1:20 – 1:50

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
2173037-97-1 Description 1634620-63-5 Purity & Documentation PMID:20301428 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

ACL6B/BAF53b Polyclonal Antibody

Product Name :
ACL6B/BAF53b Polyclonal Antibody

Species Reactivity:
Human, Mouse, Rat

Host/Isotype :
Rabbit / IgG

Class:
Polyclonal

Type :
Antibody

Clone:

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
1 mg/mL

Purification :
Protein A

Storage buffer:
PBS with 1% BSA, 50% glycerol

Contains :
0.09% sodium azide

Storage conditions:
-20°C

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
4-(Bromomethyl)benzoic acid Purity & Documentation BMS-986278 Cancer PMID:34581463 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RNA binding protein, fox-1 homolog (C. elegans) 2

Product Name :
RNA binding protein, fox-1 homolog (C. elegans) 2

Target gene :
RBFOX2

verified_species_reactivity :
Human

interspecies_information :
96%, ENSMUSG00000033565, species_id: MOUSE, 94%, ENSRNOG00000004688, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000100320

Entrez :
23543

UniProt :
O43251

Dilution:
1:500 – 1:1000

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
921618-45-3 Protocol 425399-05-9 Protocol PMID:26844335 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

MBS309

Product Name :
IL-2R betaIL-2RGPD-1

Target points:
Beijing Mabworks

Status:

Organization :

Short name :

Type:

Organism:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Axitinib Protocol Ingenol Mebutate Autophagy PMID:34787801 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RAB1A, member RAS oncogene family

Product Name :
RAB1A, member RAS oncogene family

Target gene :
RAB1A

verified_species_reactivity :
Human

interspecies_information :
100%, ENSMUSG00000020149, species_id: MOUSE, 100%, ENSRNOG00000004992, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
SAKNATNVEQSFMTMAAEIKKRMGPGA

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000138069

Entrez :
5861

UniProt :
P62820

Dilution:
1:50 – 1:200

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
875320-31-3 Protocol 2423014-07-5 web PMID:29023086 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

anti-PRND antibody, SNU R&DB Foundation

Product Name :
PRND

Target points:
Seoul National University R&DB Foundation

Status:

Organization :
Protein

Short name :
Homo sapiens

Type:

Organism:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Dexamethasone phosphate disodium Immunology/Inflammation Mirin Epigenetics PMID:35217832 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

ankyrin repeat domain 30B

Product Name :
ankyrin repeat domain 30B

Target gene :
ANKRD30B

verified_species_reactivity :
Human

interspecies_information :
26%, ENSMUSG00000064293, species_id: MOUSE, 26%, ENSRNOG00000005652, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
KASTNVDVSSVEPIFSLFGTRTIENSQCTKVEEDFNLATKIISKSAAQNYTCLPDATYQKDIKTINHKIEDQMFPS

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000180777

Entrez :
374860

UniProt :
Q9BXX2

Dilution:
1:1000 – 1:2500

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
38966-21-1 Purity 2230820-11-6 manufacturer PMID:30844158 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com