zinc finger protein 549

Product Name :
zinc finger protein 549

Target gene :
ZNF549

verified_species_reactivity :
Human

interspecies_information :
29%, ENSMUSG00000066797, species_id: MOUSE, 29%, ENSRNOG00000031569, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
QDSGEKHIRKEESSALLLNSCKIPLSDNLFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFN

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000121406

Entrez :
256051

UniProt :
Q6P9A3

Dilution:
1:50 – 1:200

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
56092-82-1 MedChemExpress 139110-80-8 Synonym PMID:29465928 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RPS6KA2 Monoclonal Antibody (1F6)

Product Name :
RPS6KA2 Monoclonal Antibody (1F6)

Species Reactivity:
Human

Host/Isotype :
Mouse / IgG2a, kappa

Class:
Monoclonal

Type :
Antibody

Clone:
1F6

Conjugate :
Unconjugated

Form:
Liquid

Concentration :

Purification :
Protein A

Storage buffer:
PBS, pH 7.4

Contains :
no preservative

Storage conditions:
-20° C, Avoid Freeze/Thaw Cycles

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Hesperetin MedChemExpress FGF-8b Protein, Human/MouseAccession PMID:34629548 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RPL32 Recombinant Rabbit Monoclonal Antibody (HL2331)

Product Name :
RPL32 Recombinant Rabbit Monoclonal Antibody (HL2331)

Species Reactivity:
Dog, Human, Mouse, Rat, Zebrafish

Host/Isotype :
Rabbit / IgG

Class:
Recombinant Monoclonal

Type :
Antibody

Clone:
HL2331

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
1 mg/mL

Purification :
Protein A

Storage buffer:
PBS

Contains :
no preservative

Storage conditions:
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

RRID:
AB_3094381

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Lenvatinib Autophagy Hydrocortisone site PMID:34253641 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

ZFP37 zinc finger protein

Product Name :
ZFP37 zinc finger protein

Target gene :
ZFP37

verified_species_reactivity :
Human

interspecies_information :
42%, ENSMUSG00000028389, species_id: MOUSE, 31%, ENSRNOG00000030118, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
MSVSSGDQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDP

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000136866

Entrez :
7539

UniProt :
Q9Y6Q3

Dilution:
1:200 – 1:500

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
2353-33-5 Description 1290543-63-3 Synonym PMID:30982975 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RORA Polyclonal Antibody

Product Name :
RORA Polyclonal Antibody

Species Reactivity:
Human, Mouse, Rat

Host/Isotype :
Rabbit / IgG

Class:
Polyclonal

Type :
Antibody

Clone:

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
0.25 mg/mL

Purification :
Antigen affinity chromatography

Storage buffer:
PBS, pH 7.3, with 50% glycerol

Contains :
0.02% sodium azide

Storage conditions:
-20°C

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Evolocumab Protocol Elexacaftor supplier PMID:34931393 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

atlastin GTPase 3

Product Name :
atlastin GTPase 3

Target gene :
ATL3

verified_species_reactivity :
Human

interspecies_information :
95%, ENSMUSG00000024759, species_id: MOUSE, 94%, ENSRNOG00000021203, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000184743

Entrez :
25923

UniProt :
Q6DD88

Dilution:

Retrieval method :

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
664334-36-5 supplier 2296729-00-3 manufacturer PMID:30137802 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

WDYHV motif containing 1

Product Name :
WDYHV motif containing 1

Target gene :
WDYHV1

verified_species_reactivity :
Human

interspecies_information :
82%, ENSMUSG00000022359, species_id: MOUSE, 84%, ENSRNOG00000006700, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000156795

Entrez :
55093

UniProt :
Q96HA8

Dilution:

Retrieval method :

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
67-68-5 Biological Activity 1869057-83-9 Formula PMID:31082167 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RNF144B Monoclonal Antibody (OTI3D7), TrueMAB™

Product Name :
RNF144B Monoclonal Antibody (OTI3D7), TrueMAB™

Species Reactivity:
Human

Host/Isotype :
Mouse / IgG1

Class:
Monoclonal

Type :
Antibody

Clone:
OTI3D7

Conjugate :
Unconjugated

Form:
lyophilized

Concentration :
1 mg/mL

Purification :
Affinity chromatography

Storage buffer:
PBS, pH 7.3, with 8% trehalose

Contains :
no preservative

Storage conditions:
-20° C, Avoid Freeze/Thaw Cycles

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Fmoc-Gln(Trt)-OH Biochemical Assay Reagents Calcein Biological Activity PMID:35022556 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RLBP1 Monoclonal Antibody (4H5)

Product Name :
RLBP1 Monoclonal Antibody (4H5)

Species Reactivity:
Human

Host/Isotype :
Mouse / IgG1, kappa

Class:
Monoclonal

Type :
Antibody

Clone:
4H5

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
See Label

Purification :
Affinity chromatography

Storage buffer:
PBS, pH 7.4

Contains :
no preservative

Storage conditions:
-20° C, Avoid Freeze/Thaw Cycles

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Lerociclib Purity & Documentation Trimethoprim site PMID:34989145 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

vaccinia related kinase 3

Product Name :
vaccinia related kinase 3

Target gene :
VRK3

verified_species_reactivity :
Human

interspecies_information :
68%, ENSMUSG00000002205, species_id: MOUSE, 73%, ENSRNOG00000026517, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000105053

Entrez :
51231

UniProt :
Q8IV63

Dilution:
1:1000 – 1:2500

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
300586-90-7 custom synthesis 879085-55-9 Formula PMID:31082139 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com