Recombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial
Product Name :
Recombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial
Brief Description :
Recombinant Proteins
Accession No. :
Q9ULT6
Calculated MW :
Target Sequence :
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Application Details :
Uniprot :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Claudin 1 Antibody Purity & Documentation 2-Iodoethanol site PMID:35121314 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com