CXCL13 (Human) Recombinant Protein
Name :
CXCL13 (Human) Recombinant Protein
Biological Activity :
Human CXCL13 (O43927, 23 a.a. – 109 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
O43927
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10563
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Molecular Weight :
12.7
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Applications :
SDS-PAGE,
Gene Name :
CXCL13
Gene Alias :
ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Gene Description :
chemokine (C-X-C motif) ligand 13
Gene Summary :
B lymphocyte chemoattractant, independently cloned and named Angie, is a CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer’s patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt’s lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq
Other Designations :
B-cell chemoattractant|B-cell-attracting chemokine 1|B-cell-homing chemokine (ligand for Burkitt’s lymphoma receptor-1)|B-lymphocyte chemoattractant|chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant)|small inducible cytokine B subfamily (Cys-X-Cys
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1RA Recombinant Proteins
IL-4 ProteinSpecies
Popular categories:
CD138/Syndecan-1
IL-3R alpha/CD123