Clcf1 (Rat) Recombinant Protein
Name :
Clcf1 (Rat) Recombinant Protein
Biological Activity :
Rat Clcf1 (P20294) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P20294
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=365395
Amino Acid Sequence :
AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Molecular Weight :
22.8
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from a concentrated (1mg/mL) solution in water containing 0.025% NaHCO3.
Applications :
Functional Study, SDS-PAGE,
Gene Name :
Clcf1
Gene Alias :
Bsf3, Clc, MGC112574, NNT-1
Gene Description :
cardiotrophin-like cytokine factor 1
Gene Summary :
Other Designations :
B-cell stimulating factor 3|cardiotrophin-like cytokine|novel neurotrophin-1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TIM-3 MedChemExpress
Neurotrophins/NGF Recombinant Proteins
Popular categories:
PDGFR
CD40