Name :
BGN (Human) Recombinant Protein

Biological Activity :
Human BGN (P21810, 38 a.a. – 368 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of bioactivity analysis

Protein Accession No. :
P21810

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=633

Amino Acid Sequence :
DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Molecular Weight :
38.3

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Viruses

Interspecies Antigen Sequence :

Preparation Method :
Baculovirus expression system

Purification :

Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

Storage Buffer :
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)

Applications :
Functional Study， SDS-PAGE，

Gene Name :
BGN

Gene Alias :
DSPG1, PG-S1, PGI, SLRR1A

Gene Description :
biglycan

Gene Summary :
The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome. [provided by RefSeq

Other Designations :
OTTHUMP00000025928|biglycan proteoglycan|bone/cartilage proteoglycan-I|dermatan sulphate proteoglycan I|small leucine-rich protein 1A

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OSM Proteinmanufacturer
IL-7 Proteinsite
Popular categories:
GMP-grade Proteins
TGF-alpha