Name :
SVBP (Human) Recombinant Protein

Biological Activity :
Human SVBP (NP_955374, 1 a.a. – 66 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :

Protein Accession No. :
Q8N300

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=374969

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSEFMDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

Molecular Weight :
10.5

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. SDS-PAGE analysis of SVBP (Human) Recombinant Protein

Storage Buffer :
In PBS, pH 7.4 (1 mM DTT, 20% glycerol).

Applications :
SDS-PAGE，

Gene Name :
CCDC23

Gene Alias :
–

Gene Description :
coiled-coil domain containing 23

Gene Summary :

Other Designations :
OTTHUMP00000008831|OTTHUMP00000008832

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-22 Proteincustom synthesis
MCP-1/CCL2 ProteinMolecular Weight
Popular categories:
Angiopoietin-4
Leukocyte Tyrosine Kinase