NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein

Name :
NPPB (Human) Recombinant Protein

Biological Activity :
Human NPPB (P16860, 103 a.a. – 134 a.a.) partial recombinant protein expressed in Escherichia coli.

Tag :

Protein Accession No. :
P16860

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4879

Amino Acid Sequence :
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Weight :
3.5

Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from sterile distilled Water up to 0.1 – 1.0 mg/ml

Applications :
Functional Study, SDS-PAGE,

Gene Name :
NPPB

Gene Alias :
BNP

Gene Description :
natriuretic peptide precursor B

Gene Summary :
This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein’s biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq

Other Designations :
OTTHUMP00000002506|OTTHUMP00000044486|brain type natriuretic peptide|natriuretic protein

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Macrosialin/CD68 ProteinSource
GM-CSF Recombinant Proteins
Popular categories:
FcRn
CXCL17

Proton-pump inhibitor

Website: