RUNX3 (Human) Recombinant Protein

RUNX3 (Human) Recombinant Protein

Name :
RUNX3 (Human) Recombinant Protein

Biological Activity :
Human RUNX3 (NP_004341, 53 a.a. – 186 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Tag :

Protein Accession No. :
NP_004341

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=864

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQK

Molecular Weight :
17.1

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Conventional Chromatography

Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE

Storage Buffer :
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 20% glycerol).

Applications :
SDS-PAGE,

Gene Name :
RUNX3

Gene Alias :
AML2, CBFA3, FLJ34510, MGC16070, PEBP2aC

Gene Description :
runt-related transcription factor 3

Gene Summary :
This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5′-PYGPYGGT-3′ found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Other Designations :
OTTHUMP00000003370|OTTHUMP00000003371|PEA2 alpha C|PEBP2 alpha C|acute myeloid leukemia gene 2|core-binding factor, runt domain, alpha subunit 3|polyomavirus enhancer-binding protein 2 alpha C subunit|transcription factor AML2

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MIG/CXCL9 Proteinsupplier
MCP-1/CCL2 ProteinPurity & Documentation
Popular categories:
Notch-4
Fc Receptor Like 2 (FCRL2)

Proton-pump inhibitor

Website: