Name :
DLX5 (Human) Recombinant Protein (P01)

Biological Activity :
Human DLX5 full-length ORF ( AAH06226, 1 a.a. – 289 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH06226

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1749

Amino Acid Sequence :
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY

Molecular Weight :
57.53

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (97); Rat (96)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
DLX5

Gene Alias :
–

Gene Description :
distal-less homeobox 5

Gene Summary :
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq

Other Designations :
distal-less homeo box 5

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IFN-γ site
LDHA Proteinsite
Popular categories:
FGF-12
Serine/Threonine Kinase 3

Name :
AGTR1 (Human) Recombinant Protein (Q01)

Biological Activity :
Human AGTR1 partial ORF ( AAH22447, 250 a.a. – 359 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH22447

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=185

Amino Acid Sequence :
FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE

Molecular Weight :
37.73

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (89); Rat (90)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
AGTR1

Gene Alias :
AG2S, AGTR1A, AGTR1B, AT1, AT1B, AT1R, AT2R1, AT2R1A, AT2R1B, HAT1R

Gene Description :
angiotensin II receptor, type 1

Gene Summary :
Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. At least five transcript variants have been described for this gene. Additional variants have been described but their full-length nature has not been determined. The entire coding sequence is contained in the terminal exon and is present in all transcript variants. [provided by RefSeq

Other Designations :
angiotensin receptor 1|angiotensin receptor 1B|type-1B angiotensin II receptor

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EDAR Proteinmedchemexpress
Eph receptors Recombinant Proteins
Popular categories:
Kelch-Like Protein 2 (KLHL2)
Serpin B6b

Name :
ZFP3 (Human) Recombinant Protein (P01)

Biological Activity :
Human ZFP3 full-length ORF ( NP_694563.1, 1 a.a. – 502 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_694563.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=124961

Amino Acid Sequence :
MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQERDFPSGLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSSHLIHHHRIHTGERPYKCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECNECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQRIHTGDKPYECNECGKTFGQNSEIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKPHQCNECARTFWDNSELLLHQKIHIGEKPYECSECEKTFSQHSQLIIHQRIHTGEKPYECQECQKTFSRSSHLLRHQSVHCME

Molecular Weight :
84.1

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (86); Rat (87)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
ZFP3

Gene Alias :
FLJ30726, ZNF752

Gene Description :
zinc finger protein 3 homolog (mouse)

Gene Summary :

Other Designations :
zinc finger protein homologous to Zfp-3 in mouse|zinc finger protein-3

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Growth Differentiation Factor Recombinant Proteins
Carbonic Anhydrase 1 ProteinMedChemExpress
Popular categories:
Amphiregulin
Membrane Cofactor Protein

Name :
TRA16 (Human) Recombinant Protein (P01)

Biological Activity :
Human TRA16 full-length ORF ( NP_795361.1, 1 a.a. – 139 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_795361.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=126382

Amino Acid Sequence :
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV

Molecular Weight :
42.3

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (83); Rat (80)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
NR2C2AP

Gene Alias :
TRA16

Gene Description :
nuclear receptor 2C2-associated protein

Gene Summary :

Other Designations :
TR4 orphan receptor associated protein TRA16|repressor for TR4 transactivation

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cystatin Family MedChemExpress
HGF site
Popular categories:
MMP-23
PTH

Name :
LRIG3 (Human) Recombinant Protein (Q01)

Biological Activity :
Human LRIG3 partial ORF ( NP_700356, 1020 a.a. – 1119 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_700356

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=121227

Amino Acid Sequence :
LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT

Molecular Weight :
36.74

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (66); Rat (67)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
LRIG3

Gene Alias :
FLJ26573, FLJ90440, KIAA3016, LIG3

Gene Description :
leucine-rich repeats and immunoglobulin-like domains 3

Gene Summary :

Other Designations :
–

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B18R ProteinPurity & Documentation
CFHR5 ProteinAccession
Popular categories:
Tyrosine-protein Kinase Lyn
LRP-1/CD91

Product Name :
Recombinant Human DHRS9 Protein

Product Name :
WFDC2 Recombinant Rabbit Monoclonal Antibody (404)

Name :
WDR92 (Human) Recombinant Protein (P01)

Biological Activity :
Human WDR92 full-length ORF ( NP_612467.1, 1 a.a. – 357 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_612467.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=116143

Amino Acid Sequence :
MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKI

Molecular Weight :
66.1

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (93); Rat (93)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
WDR92

Gene Alias :
FLJ31741

Gene Description :
WD repeat domain 92

Gene Summary :
The WD40 repeat domain is a common structural module in eukaryotes, and proteins containing WD40 domains have a diverse range of functions, including signal transduction, cell cycle regulation, RNA splicing, and transcription (Saeki et al., 2006 [PubMed 16487927]).[supplied by OMIM

Other Designations :
monad

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-23 Receptor Recombinant Proteins
B7-H3 MedChemExpress
Popular categories:
SARS-CoV-2 Non-structural Proteins
TSH Receptor

Product Name :
Recombinant Collagen Type XI Alpha 1 (COL11a1)

Product Name :
WDR83 Polyclonal Antibody